Show sidebar
Show 9 12 18 24
Clear filters
KPV Peptide 10mg
Quick view
Add to compare
Add to wishlist

KPV Peptide

Price range: $39.99 through $125.00

Key Product Specifications:

  • Peptide Name: KPV (Lysine–Proline–Valine)

  • Form: Lyophilized powder

  • Purity: ≥98% (HPLC Verified)

  • Net Content: 10mg/5mg per vial

  • Molecular Formula: C17H32N6O4

  • Molecular Weight: ~384.5 g/mol

  • Sequence: Lys-Pro-Val

  • Storage: Store dry at -20°C; use reconstituted solution within 30 days at 2–8°C

  • Solubility: Soluble in sterile water or peptide-grade solvents

Select options This product has multiple variants. The options may be chosen on the product page
lanreotide
Quick view
Add to compare
Add to wishlist

Lanreotide Peptide

Price range: $100.00 through $180.00

Product Name: Lanreotide
Synonyms: BIM-23014, Somatuline Analog, Somatostatin-14 Analog
CAS Number: 108736-35-2
Molecular Formula: C54H69N11O10S2
Molecular Weight: ~1110.32 g/mol
Form: Lyophilized Powder
Purity: ≥98% (HPLC Verified, U.S. Lab Standard)
Available Sizes: 5mg and 10mg vials
Storage (Lyophilized): –20°C, dry and dark
Storage (Reconstituted): 2–8°C (stable for up to 30 days)
Use: For research use only in U.S. laboratories

Select options This product has multiple variants. The options may be chosen on the product page
LC216
Quick view
Add to compare
Add to wishlist

LC216 – Advanced Lipolytic Peptide

$74.99

📋 Technical Specifications:

Property Specification
Product Name LC216
Form Lyophilized powder
Dosage Strength 10mg per vial
Purity ≥ 99%
Molecular Class Lipolytic Research Peptide
Appearance White/off-white powder
Storage Temp 2°C–8°C
Shelf Life 24 months (unopened)
Classification Research Use Only
Select options This product has multiple variants. The options may be chosen on the product page
Letrozole
Quick view
Add to compare
Add to wishlist

Letrozole (Femara) for Sale – High Purity Aromatase Inhibitor Powder

Price range: $280.00 through $1,900.00

Key Features

  • 💎 Lab-tested purity >99%

  • 🧪 Non-steroidal third-generation AI

  • 🔥 Among the strongest estrogen-lowering compounds

  • 🚫 Prevents gynecomastia & water retention in research models

  • âš¡ Long half-life for sustained estrogen control

Select options This product has multiple variants. The options may be chosen on the product page
Buy LGD-4033 (Ligandrol) – High Purity SARMs for Sale USA
Quick view
Add to compare
Add to wishlist

LGD-4033 (Ligandrol)

Price range: $165.00 through $11,000.00

Key Features

  • Compound Name: LGD-4033 (Ligandrol)

  • Category: Selective Androgen Receptor Modulator (SARM)

  • Form: Oral (capsules, tablets, or liquid solution)

  • Half-Life: ~24–36 hours (once-daily dosing)

  • Legality: For research purposes only (not FDA-approved for human use)

Select options This product has multiple variants. The options may be chosen on the product page
Lipotropic Peptide
Quick view
Add to compare
Add to wishlist

Lipo B – Lipotropic Peptide Complex

$44.99

📋 Product Specifications:

Attribute Specification
Product Name Lipo B 10mg
Classification Lipotropic Compound (Research)
Form Lyophilized powder
Purity ≥ 99%
Storage Temp 2°C–8°C (Refrigerated)
Shelf Life 24 Months (unopened)
Usage Research and Laboratory Only
Select options This product has multiple variants. The options may be chosen on the product page
Lipo C 10mg, lipotropic peptide, MIC peptide for research, Methionine Inositol Choline blend, Lipo C fat metabolism, Lipo C liver detox, lipotropic compound USA, research peptide Lipo C, metabolic peptide research, buy Lipo C online, Lipo C for laboratory use, fat burning peptide, lipolytic peptide blend, Lipo C injection research, B12 peptide complex
Quick view
Add to compare
Add to wishlist

LIPO C 10 mL (10 vials)

$49.99

📋 Technical Specifications:

Property Specification
Product Name Lipo C 10mg
Form Lyophilized Powder
Purity ≥ 99%
Appearance White/off-white crystalline
Storage Temperature 2°C–8°C (Refrigerated)
Shelf Life 24 Months (Unopened)
Use Research & Laboratory Only
Select options This product has multiple variants. The options may be chosen on the product page
LL-37 5mg
Quick view
Add to compare
Add to wishlist

LL-37 Peptide 5mg & 10mg (Research Grade)

Price range: $200.00 through $280.00

Product Features:

  • Name: LL-37

  • Form: Lyophilized powder

  • Purity: ≥98% (HPLC Tested)

  • Available Dosages: 5mg / 10mg per vial

  • Sequence: [LL-37, 37 aa]

  • Molecular Weight: ~4493.3 g/mol

  • Storage: Store at -20°C; stable for 30 days after reconstitution (2-8°C)

  • Research Use: Inflammation, immunity, antimicrobial action, tissue regeneration

Select options This product has multiple variants. The options may be chosen on the product page
MAST-200
Quick view
Add to compare
Add to wishlist

MAST-200 (Drostanolone Enanthate 200mg)

Price range: $960.00 through $1,450.00

Key Features

  • Long-acting Drostanolone Enanthate ester (200mg/ml)

  • Powerful muscle-hardening & definition enhancer

  • Anti-estrogenic properties (no water retention)

  • Helps burn fat while preserving lean muscle

  • Convenient low-frequency injection schedule

  • Ideal for cutting & contest prep cycles

Select options This product has multiple variants. The options may be chosen on the product page
Melanotan I
Quick view
Add to compare
Add to wishlist

Melanotan I (MT1)

$95.00

Product Name: Melanotan I (MT1)
Synonyms: Afamelanotide, NDP-MSH, Alpha-MSH analog
CAS Number: 75921-69-6
Molecular Formula: C78H111N21O19
Molecular Weight: 1646.9 g/mol
Purity: ≥98% (HPLC Verified)
Form: Lyophilized White Powder
Storage (Lyophilized): -20°C, dry and protected from light
Storage (Reconstituted): 2–8°C; use within 15–30 days
Use: For Research Use Only – Not for Human or Veterinary Use

Select options This product has multiple variants. The options may be chosen on the product page
Melanotan II
Quick view
Add to compare
Add to wishlist

Melanotan II

$95.00

Product Name: Melanotan II
Synonyms: MT2, Melanotan 2, Melanocyte Stimulating Hormone Analog
CAS Number: 121062-08-6
Molecular Formula: C50H69N15O9
Molecular Weight: 1024.18 g/mol
Purity: ≥98% (HPLC Verified)
Form: Lyophilized White Powder
Storage (Lyophilized): -20°C, dry and light-protected
Storage (Reconstituted): 2–8°C, stable for 15–30 days
Use: For Laboratory Research Use Only – Not for Human or Veterinary Use

Select options This product has multiple variants. The options may be chosen on the product page
Mesterolon
Quick view
Add to compare
Add to wishlist

Mesterolone (Proviron) for Sale – High Purity Oral Steroid Powder

Price range: $730.00 through $5,200.00

Key Features

  • 💎 Lab-tested purity >99%

  • 💊 Orally bioavailable – non-hepatotoxic

  • 🚫 Does not aromatize into estrogen

  • 🔥 Muscle-hardening & anti-estrogenic support

  • âš¡ Popular for stacking in cutting cycles

Select options This product has multiple variants. The options may be chosen on the product page