Showing 169–180 of 345 results

LGD-4033 (Ligandrol)

Price range: $82.50 through $5,500.00

Key Features

  • Compound Name: LGD-4033 (Ligandrol)

  • Category: Selective Androgen Receptor Modulator (SARM)

  • Form: Oral (capsules, tablets, or liquid solution)

  • Half-Life: ~24–36 hours (once-daily dosing)

  • Legality: For research purposes only (not FDA-approved for human use)

Select options This product has multiple variants. The options may be chosen on the product page

LIDOCAINE CREAM 10.56%

$20.00
Specification Details
Product Name LIDOCAINE CREAM 10.56%
Active Ingredient Lidocaine
Strength 10.56%
Packaging 500g Jar/Tube
Product Type Topical Anesthetic Cream
Application Skin Numbing / Pain Reduction
Usage Professional Use Recommended
Storage Cool and Dry Place

Lipo B – Lipotropic Peptide Complex

$22.00

???? Product Specifications:

Attribute Specification
Product Name Lipo B 10mg
Classification Lipotropic Compound (Research)
Form Lyophilized powder
Purity ≥ 99%
Storage Temp 2°C–8°C (Refrigerated)
Shelf Life 24 Months (unopened)
Usage Research and Laboratory Only
Select options This product has multiple variants. The options may be chosen on the product page

LIPO C 10 mL (10 vials)

$24.50

???? Technical Specifications:

Property Specification
Product Name Lipo C 10mg
Form Lyophilized Powder
Purity ≥ 99%
Appearance White/off-white crystalline
Storage Temperature 2°C–8°C (Refrigerated)
Shelf Life 24 Months (Unopened)
Use Research & Laboratory Only
Select options This product has multiple variants. The options may be chosen on the product page

LIPO LAB Phosphatidylcholine Mesotherapy Injection

$30.00
Specification Details
Product Name LIPO LAB
Active Ingredient Phosphatidylcholine
Product Type Mesotherapy Injectable Solution
Application Lipolysis & Body Contouring
Usage Professional Use Only
Form Sterile Injectable
Storage Cool and Dry Place
Packaging Manufacturer-Sealed Product

LIPO LAB V-LINE FOR FACE Phosphatidylcholine

$30.00
Specification Details
Product Name LIPO LAB V-LINE FOR FACE
Active Ingredient Phosphatidylcholine
Product Type Mesotherapy Injectable Solution
Application Facial Contouring & V-Line Therapy
Usage Professional Use Only
Form Sterile Injectable
Storage Cool and Dry Place
Packaging Manufacturer-Sealed Product

LIPORASE HA Filler Dissolver

$22.00
Specification Details
Product Type HA Filler Dissolver
Main Ingredient Hyaluronidase
Purpose Dissolve Hyaluronic Acid Fillers
Form Lyophilized Powder
Administration Injectable Solution
Duration of Action Rapid Enzymatic Activity
Packaging Sterile Vial
Sterility Sterile Sealed Product
Application Areas Lips, Face, Under Eyes, Jawline
Professional Use Yes
Storage Condition Store in Cool Dry Place

LIPORASE Hyaluronidase

$19.00
Specification Details
Product Name LIPORASE Hyaluronidase
Packaging 10 Vials per Box
Main Ingredient Hyaluronidase
Application Dermal Filler Dissolver
Usage Professional Cosmetic Procedures
Form Injectable Powder/Vial
Sterility Sterile Medical Product
Storage Cool, Dry Place

LIPOTOCINE Thioctic Acid Tromethamine

$22.00
Specification Details
Product Name LIPOTOCINE
Active Ingredient Thioctic Acid (Alpha Lipoic Acid)
Additional Ingredient Tromethamine
Product Type Injectable Solution
Application Wellness & Antioxidant Therapy
Usage Professional Use Only
Storage Cool and Dry Place
Packaging Manufacturer-Sealed Product

LL-37 Peptide 5mg & 10mg (Research Grade)

Price range: $100.00 through $140.00

Product Features:

  • Name: LL-37

  • Form: Lyophilized powder

  • Purity: ≥98% (HPLC Tested)

  • Available Dosages: 5mg / 10mg per vial

  • Sequence: [LL-37, 37 aa]

  • Molecular Weight: ~4493.3 g/mol

  • Storage: Store at -20°C; stable for 30 days after reconstitution (2-8°C)

  • Research Use: Inflammation, immunity, antimicrobial action, tissue regeneration

Select options This product has multiple variants. The options may be chosen on the product page

LUNATOX Cream

$14.90
Specification Details
Product Name LUNATOX Cream
Product Type Rejuvenating & Moisturizing Cream
Application Method Topical Skincare Use
Origin South Korea
Storage Store at room temperature

LUTHIONE INJ. 1200MG

$29.00
Specification Details
Product Name LUTHIONE INJ. 1200MG
Active Ingredient Glutathione
Strength 1200MG
Product Type Injectable Solution
Application Wellness & Antioxidant Therapy
Usage Professional Use Only
Packaging Manufacturer-Sealed Product
Storage Cool, Dry Place