GHRPs
6 products
Showing 169–180 of 348 results
LGD-4033 (Ligandrol)
Rated 0 out of 5
$82.50 – $5,500.00Price range: $82.50 through $5,500.00
Key Features
-
Compound Name: LGD-4033 (Ligandrol)
-
Category: Selective Androgen Receptor Modulator (SARM)
-
Form: Oral (capsules, tablets, or liquid solution)
-
Half-Life: ~24–36 hours (once-daily dosing)
-
Legality: For research purposes only (not FDA-approved for human use)
Select options
This product has multiple variants. The options may be chosen on the product page
LIDOCAINE CREAM 10.56%
Rated 0 out of 5
$20.00
| Specification | Details |
|---|---|
| Product Name | LIDOCAINE CREAM 10.56% |
| Active Ingredient | Lidocaine |
| Strength | 10.56% |
| Packaging | 500g Jar/Tube |
| Product Type | Topical Anesthetic Cream |
| Application | Skin Numbing / Pain Reduction |
| Usage | Professional Use Recommended |
| Storage | Cool and Dry Place |
Lipo B – Lipotropic Peptide Complex
Rated 0 out of 5
$22.00
???? Product Specifications:
| Attribute | Specification |
|---|---|
| Product Name | Lipo B 10mg |
| Classification | Lipotropic Compound (Research) |
| Form | Lyophilized powder |
| Purity | ≥ 99% |
| Storage Temp | 2°C–8°C (Refrigerated) |
| Shelf Life | 24 Months (unopened) |
| Usage | Research and Laboratory Only |
Select options
This product has multiple variants. The options may be chosen on the product page
LIPO C 10 mL (10 vials)
Rated 0 out of 5
$24.50
???? Technical Specifications:
| Property | Specification |
|---|---|
| Product Name | Lipo C 10mg |
| Form | Lyophilized Powder |
| Purity | ≥ 99% |
| Appearance | White/off-white crystalline |
| Storage Temperature | 2°C–8°C (Refrigerated) |
| Shelf Life | 24 Months (Unopened) |
| Use | Research & Laboratory Only |
Select options
This product has multiple variants. The options may be chosen on the product page
LIPO LAB Phosphatidylcholine Mesotherapy Injection
Rated 0 out of 5
$30.00
| Specification | Details |
|---|---|
| Product Name | LIPO LAB |
| Active Ingredient | Phosphatidylcholine |
| Product Type | Mesotherapy Injectable Solution |
| Application | Lipolysis & Body Contouring |
| Usage | Professional Use Only |
| Form | Sterile Injectable |
| Storage | Cool and Dry Place |
| Packaging | Manufacturer-Sealed Product |
LIPO LAB V-LINE FOR FACE Phosphatidylcholine
Rated 0 out of 5
$30.00
| Specification | Details |
|---|---|
| Product Name | LIPO LAB V-LINE FOR FACE |
| Active Ingredient | Phosphatidylcholine |
| Product Type | Mesotherapy Injectable Solution |
| Application | Facial Contouring & V-Line Therapy |
| Usage | Professional Use Only |
| Form | Sterile Injectable |
| Storage | Cool and Dry Place |
| Packaging | Manufacturer-Sealed Product |
LIPORASE HA Filler Dissolver
Rated 0 out of 5
$22.00
| Specification | Details |
|---|---|
| Product Type | HA Filler Dissolver |
| Main Ingredient | Hyaluronidase |
| Purpose | Dissolve Hyaluronic Acid Fillers |
| Form | Lyophilized Powder |
| Administration | Injectable Solution |
| Duration of Action | Rapid Enzymatic Activity |
| Packaging | Sterile Vial |
| Sterility | Sterile Sealed Product |
| Application Areas | Lips, Face, Under Eyes, Jawline |
| Professional Use | Yes |
| Storage Condition | Store in Cool Dry Place |
LIPORASE Hyaluronidase
Rated 0 out of 5
$19.00
| Specification | Details |
|---|---|
| Product Name | LIPORASE Hyaluronidase |
| Packaging | 10 Vials per Box |
| Main Ingredient | Hyaluronidase |
| Application | Dermal Filler Dissolver |
| Usage | Professional Cosmetic Procedures |
| Form | Injectable Powder/Vial |
| Sterility | Sterile Medical Product |
| Storage | Cool, Dry Place |
LIPOTOCINE Thioctic Acid Tromethamine
Rated 0 out of 5
$22.00
| Specification | Details |
|---|---|
| Product Name | LIPOTOCINE |
| Active Ingredient | Thioctic Acid (Alpha Lipoic Acid) |
| Additional Ingredient | Tromethamine |
| Product Type | Injectable Solution |
| Application | Wellness & Antioxidant Therapy |
| Usage | Professional Use Only |
| Storage | Cool and Dry Place |
| Packaging | Manufacturer-Sealed Product |
LL-37 Peptide 5mg & 10mg (Research Grade)
Rated 0 out of 5
$100.00 – $140.00Price range: $100.00 through $140.00
Product Features:
-
Name: LL-37
-
Form: Lyophilized powder
-
Purity: ≥98% (HPLC Tested)
-
Available Dosages: 5mg / 10mg per vial
-
Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
-
Molecular Weight: ~4493.3 g/mol
-
Storage: Store at -20°C; stable for 30 days after reconstitution (2-8°C)
-
Research Use: Inflammation, immunity, antimicrobial action, tissue regeneration
Select options
This product has multiple variants. The options may be chosen on the product page
LUNATOX Cream
Rated 0 out of 5
$14.90
| Specification | Details |
|---|---|
| Product Name | LUNATOX Cream |
| Product Type | Rejuvenating & Moisturizing Cream |
| Application Method | Topical Skincare Use |
| Origin | South Korea |
| Storage | Store at room temperature |
LUTHIONE INJ. 1200MG
Rated 0 out of 5
$29.00
| Specification | Details |
|---|---|
| Product Name | LUTHIONE INJ. 1200MG |
| Active Ingredient | Glutathione |
| Strength | 1200MG |
| Product Type | Injectable Solution |
| Application | Wellness & Antioxidant Therapy |
| Usage | Professional Use Only |
| Packaging | Manufacturer-Sealed Product |
| Storage | Cool, Dry Place |