GHRPs
Showing 109–120 of 202 results
LL-37 Peptide 5mg & 10mg (Research Grade)
Product Features:
-
Name: LL-37
-
Form: Lyophilized powder
-
Purity: ≥98% (HPLC Tested)
-
Available Dosages: 5mg / 10mg per vial
-
Sequence: [LL-37, 37 aa]
-
Molecular Weight: ~4493.3 g/mol
-
Storage: Store at -20°C; stable for 30 days after reconstitution (2-8°C)
-
Research Use: Inflammation, immunity, antimicrobial action, tissue regeneration
MAST-200 (Drostanolone Enanthate 200mg)
Key Features
-
Long-acting Drostanolone Enanthate ester (200mg/ml)
-
Powerful muscle-hardening & definition enhancer
-
Anti-estrogenic properties (no water retention)
-
Helps burn fat while preserving lean muscle
-
Convenient low-frequency injection schedule
-
Ideal for cutting & contest prep cycles
Melanotan I (MT1)
Product Name: Melanotan I (MT1)
Synonyms: Afamelanotide, NDP-MSH, Alpha-MSH analog
CAS Number: 75921-69-6
Molecular Formula: C78H111N21O19
Molecular Weight: 1646.9 g/mol
Purity: ≥98% (HPLC Verified)
Form: Lyophilized White Powder
Storage (Lyophilized): -20°C, dry and protected from light
Storage (Reconstituted): 2–8°C; use within 15–30 days
Use: For Research Use Only – Not for Human or Veterinary Use
Melanotan II
Product Name: Melanotan II
Synonyms: MT2, Melanotan 2, Melanocyte Stimulating Hormone Analog
CAS Number: 121062-08-6
Molecular Formula: C50H69N15O9
Molecular Weight: 1024.18 g/mol
Purity: ≥98% (HPLC Verified)
Form: Lyophilized White Powder
Storage (Lyophilized): -20°C, dry and light-protected
Storage (Reconstituted): 2–8°C, stable for 15–30 days
Use: For Laboratory Research Use Only – Not for Human or Veterinary Use
Mesterolone (Proviron) for Sale – High Purity Oral Steroid Powder
Key Features
-
💎 Lab-tested purity >99%
-
💊 Orally bioavailable – non-hepatotoxic
-
🚫 Does not aromatize into estrogen
-
🔥 Muscle-hardening & anti-estrogenic support
-
⚡ Popular for stacking in cutting cycles
Methandienone (Dianabol) for Sale – High Purity Oral Steroid Powder
Key Features
-
💎 Lab-tested purity >99%
-
💊 Orally bioavailable (C17-aa modification)
-
⚡ Powerful bulking & mass-gain compound
-
🚫 Moderate androgenic profile compared to testosterone
-
🔥 Classic research steroid with decades of study history
Methasteron (Superdrol) for Sale – High Purity Oral Steroid Powder
Key Features
-
💎 Pharmaceutical-grade >99% purity
-
💊 Oral bioavailability – no injections required
-
⚡ Extreme anabolic potency (400+)
-
🚫 Non-aromatizing – no estrogen conversion
-
⏱️ Fast-acting – visible results within weeks
Methenolone Acetate (Primobolan Acetate) for Sale – High Purity Steroid Powder & Injectable Solution
Key Features
-
💎 High-purity (>99%) pharmaceutical grade
-
🧪 Available as raw powder & injectable solution
-
⚖️ Mild anabolic, low androgenic properties
-
🚫 Non-aromatizing – no estrogen conversion
-
🔄 Short-acting acetate ester (2–3 day half-life)
Methenolone Enanthate (Primobolan Depot) for Sale – High Purity Steroid Powder & Injectable Solution
Key Features
-
💎 Pharmaceutical grade, >99% purity
-
🧪 Available in raw powder & injectable solution
-
⏳ Long half-life (7–10 days) for convenient dosing schedules
-
🚫 Non-aromatizing – no estrogen conversion
-
⚖️ Mild anabolic, low androgenic profile
Methenolone Enanthate 100mg (Primobolan Enanthate)
Key Features
-
Mild anabolic steroid with low androgenic effects
-
Non-aromatizing (no estrogenic side effects)
-
Supports muscle preservation during cutting cycles
-
Enhances definition, vascularity, and lean appearance
-
Long-acting ester – injections required only 1–2 times per week
-
Suitable for beginners and advanced users
Methyltestosterone for Sale
Key Features
-
Compound Name: Methyltestosterone
-
Category: Oral Anabolic-Androgenic Steroid (AAS)
-
Form: Oral tablets / capsules / raw powder
-
Half-Life: 3–4 hours (short duration)
-
Legality: Controlled in many countries. Available for research use only.
MGF (Mechano Growth Factor)
Product Name: MGF Peptide
Synonyms: IGF-1Ec, Mechano Growth Factor, IGF-1 splice variant
CAS Number: 116541-27-4
Molecular Formula: C121H200N42O39
Molecular Weight: 2867.2 g/mol
Purity: ≥98% (HPLC Verified)
Form: Lyophilized Powder
Storage: Store at -20°C; once reconstituted, refrigerate at 2°C–8°C
Use: For Laboratory Research Only – Not for Human Consumption