LL-37 Peptide 5mg & 10mg (Research Grade)
$200.00 – $280.00Price range: $200.00 through $280.00
Product Features:
-
Name: LL-37
-
Form: Lyophilized powder
-
Purity: ≥98% (HPLC Tested)
-
Available Dosages: 5mg / 10mg per vial
-
Sequence: [LL-37, 37 aa]
-
Molecular Weight: ~4493.3 g/mol
-
Storage: Store at -20°C; stable for 30 days after reconstitution (2-8°C)
-
Research Use: Inflammation, immunity, antimicrobial action, tissue regeneration
LL-37 Peptide 5mg & 10mg (For Research Use Only)
LL-37 is a human cationic antimicrobial peptide derived from the cathelicidin family, widely studied for its role in innate immunity, inflammation modulation, wound healing, and tissue regeneration. Offered in both 5mg and 10mg lyophilized vials, It is a popular research peptide for immune system modulation, microbiology, and inflammatory disease studies.
This 37-amino acid peptide exhibits broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria, fungi, and some viruses. It is also involved in chemotaxis, angiogenesis, and epithelial barrier repair, making it a vital tool in cutting-edge medical and therapeutic research.
Manufactured with >98% purity and rigorously tested for consistency, LL-37 from this source is ideal for academic and clinical research use.
Product Features:
-
Name: LL-37
-
Form: Lyophilized powder
-
Purity: ≥98% (HPLC Tested)
-
Available Dosages: 5mg / 10mg per vial
-
Sequence: [LL-37, 37 aa]
-
Molecular Weight: ~4493.3 g/mol
-
Storage: Store at -20°C; stable for 30 days after reconstitution (2-8°C)
-
Research Use: Inflammation, immunity, antimicrobial action, tissue regeneration
Research Applications Of LL-37:
-
Antimicrobial activity studies
-
Wound healing and tissue repair
-
Inflammatory disease modeling
-
Cancer immunotherapy research
-
Gut and skin microbiome investigations
-
Epithelial barrier function research
Disclaimer:
For Research Use Only. Not for human or veterinary use.
LL-37 is intended exclusively for laboratory and scientific use by qualified professionals. Not for drug, diagnostic, or therapeutic purposes.
Related Products
