GHRPs
KPV Peptide
Price range: $39.99 through $125.00Key Product Specifications:
-
Peptide Name: KPV (Lysine–Proline–Valine)
-
Form: Lyophilized powder
-
Purity: ≥98% (HPLC Verified)
-
Net Content: 10mg/5mg per vial
-
Molecular Formula: C17H32N6O4
-
Molecular Weight: ~384.5 g/mol
-
Sequence: Lys-Pro-Val
-
Storage: Store dry at -20°C; use reconstituted solution within 30 days at 2–8°C
-
Solubility: Soluble in sterile water or peptide-grade solvents
Lanreotide Peptide
Price range: $100.00 through $180.00Product Name: Lanreotide
Synonyms: BIM-23014, Somatuline Analog, Somatostatin-14 Analog
CAS Number: 108736-35-2
Molecular Formula: C54H69N11O10S2
Molecular Weight: ~1110.32 g/mol
Form: Lyophilized Powder
Purity: ≥98% (HPLC Verified, U.S. Lab Standard)
Available Sizes: 5mg and 10mg vials
Storage (Lyophilized): –20°C, dry and dark
Storage (Reconstituted): 2–8°C (stable for up to 30 days)
Use: For research use only in U.S. laboratories
LC216 – Advanced Lipolytic Peptide
$74.99📋 Technical Specifications:
| Property | Specification |
|---|---|
| Product Name | LC216 |
| Form | Lyophilized powder |
| Dosage Strength | 10mg per vial |
| Purity | ≥ 99% |
| Molecular Class | Lipolytic Research Peptide |
| Appearance | White/off-white powder |
| Storage Temp | 2°C–8°C |
| Shelf Life | 24 months (unopened) |
| Classification | Research Use Only |
Letrozole (Femara) for Sale – High Purity Aromatase Inhibitor Powder
Price range: $280.00 through $1,900.00Key Features
-
💎 Lab-tested purity >99%
-
🧪 Non-steroidal third-generation AI
-
🔥 Among the strongest estrogen-lowering compounds
-
🚫 Prevents gynecomastia & water retention in research models
-
âš¡ Long half-life for sustained estrogen control
LGD-4033 (Ligandrol)
Price range: $165.00 through $11,000.00Key Features
-
Compound Name: LGD-4033 (Ligandrol)
-
Category: Selective Androgen Receptor Modulator (SARM)
-
Form: Oral (capsules, tablets, or liquid solution)
-
Half-Life: ~24–36 hours (once-daily dosing)
-
Legality: For research purposes only (not FDA-approved for human use)
Lipo B – Lipotropic Peptide Complex
$44.99📋 Product Specifications:
| Attribute | Specification |
|---|---|
| Product Name | Lipo B 10mg |
| Classification | Lipotropic Compound (Research) |
| Form | Lyophilized powder |
| Purity | ≥ 99% |
| Storage Temp | 2°C–8°C (Refrigerated) |
| Shelf Life | 24 Months (unopened) |
| Usage | Research and Laboratory Only |
LIPO C 10 mL (10 vials)
$49.99📋 Technical Specifications:
| Property | Specification |
|---|---|
| Product Name | Lipo C 10mg |
| Form | Lyophilized Powder |
| Purity | ≥ 99% |
| Appearance | White/off-white crystalline |
| Storage Temperature | 2°C–8°C (Refrigerated) |
| Shelf Life | 24 Months (Unopened) |
| Use | Research & Laboratory Only |
LL-37 Peptide 5mg & 10mg (Research Grade)
Price range: $200.00 through $280.00Product Features:
-
Name: LL-37
-
Form: Lyophilized powder
-
Purity: ≥98% (HPLC Tested)
-
Available Dosages: 5mg / 10mg per vial
-
Sequence: [LL-37, 37 aa]
-
Molecular Weight: ~4493.3 g/mol
-
Storage: Store at -20°C; stable for 30 days after reconstitution (2-8°C)
-
Research Use: Inflammation, immunity, antimicrobial action, tissue regeneration
MAST-200 (Drostanolone Enanthate 200mg)
Price range: $960.00 through $1,450.00Key Features
-
Long-acting Drostanolone Enanthate ester (200mg/ml)
-
Powerful muscle-hardening & definition enhancer
-
Anti-estrogenic properties (no water retention)
-
Helps burn fat while preserving lean muscle
-
Convenient low-frequency injection schedule
-
Ideal for cutting & contest prep cycles
Melanotan I (MT1)
$95.00Product Name: Melanotan I (MT1)
Synonyms: Afamelanotide, NDP-MSH, Alpha-MSH analog
CAS Number: 75921-69-6
Molecular Formula: C78H111N21O19
Molecular Weight: 1646.9 g/mol
Purity: ≥98% (HPLC Verified)
Form: Lyophilized White Powder
Storage (Lyophilized): -20°C, dry and protected from light
Storage (Reconstituted): 2–8°C; use within 15–30 days
Use: For Research Use Only – Not for Human or Veterinary Use
Melanotan II
$95.00Product Name: Melanotan II
Synonyms: MT2, Melanotan 2, Melanocyte Stimulating Hormone Analog
CAS Number: 121062-08-6
Molecular Formula: C50H69N15O9
Molecular Weight: 1024.18 g/mol
Purity: ≥98% (HPLC Verified)
Form: Lyophilized White Powder
Storage (Lyophilized): -20°C, dry and light-protected
Storage (Reconstituted): 2–8°C, stable for 15–30 days
Use: For Laboratory Research Use Only – Not for Human or Veterinary Use
Mesterolone (Proviron) for Sale – High Purity Oral Steroid Powder
Price range: $730.00 through $5,200.00Key Features
-
💎 Lab-tested purity >99%
-
💊 Orally bioavailable – non-hepatotoxic
-
🚫 Does not aromatize into estrogen
-
🔥 Muscle-hardening & anti-estrogenic support
-
âš¡ Popular for stacking in cutting cycles