LIPO C 10 mL (10 vials)
$49.99📋 Technical Specifications:
| Property | Specification |
|---|---|
| Product Name | Lipo C 10mg |
| Form | Lyophilized Powder |
| Purity | ≥ 99% |
| Appearance | White/off-white crystalline |
| Storage Temperature | 2°C–8°C (Refrigerated) |
| Shelf Life | 24 Months (Unopened) |
| Use | Research & Laboratory Only |
LL-37 Peptide 5mg & 10mg (Research Grade)
Price range: $200.00 through $280.00Product Features:
-
Name: LL-37
-
Form: Lyophilized powder
-
Purity: ≥98% (HPLC Tested)
-
Available Dosages: 5mg / 10mg per vial
-
Sequence: [LL-37, 37 aa]
-
Molecular Weight: ~4493.3 g/mol
-
Storage: Store at -20°C; stable for 30 days after reconstitution (2-8°C)
-
Research Use: Inflammation, immunity, antimicrobial action, tissue regeneration
Melanotan I (MT1)
$95.00Product Name: Melanotan I (MT1)
Synonyms: Afamelanotide, NDP-MSH, Alpha-MSH analog
CAS Number: 75921-69-6
Molecular Formula: C78H111N21O19
Molecular Weight: 1646.9 g/mol
Purity: ≥98% (HPLC Verified)
Form: Lyophilized White Powder
Storage (Lyophilized): -20°C, dry and protected from light
Storage (Reconstituted): 2–8°C; use within 15–30 days
Use: For Research Use Only – Not for Human or Veterinary Use
Melanotan II
$95.00Product Name: Melanotan II
Synonyms: MT2, Melanotan 2, Melanocyte Stimulating Hormone Analog
CAS Number: 121062-08-6
Molecular Formula: C50H69N15O9
Molecular Weight: 1024.18 g/mol
Purity: ≥98% (HPLC Verified)
Form: Lyophilized White Powder
Storage (Lyophilized): -20°C, dry and light-protected
Storage (Reconstituted): 2–8°C, stable for 15–30 days
Use: For Laboratory Research Use Only – Not for Human or Veterinary Use
MGF (Mechano Growth Factor)
Price range: $70.00 through $170.00Product Name: MGF Peptide
Synonyms: IGF-1Ec, Mechano Growth Factor, IGF-1 splice variant
CAS Number: 116541-27-4
Molecular Formula: C121H200N42O39
Molecular Weight: 2867.2 g/mol
Purity: ≥98% (HPLC Verified)
Form: Lyophilized Powder
Storage: Store at -20°C; once reconstituted, refrigerate at 2°C–8°C
Use: For Laboratory Research Only – Not for Human Consumption
MOG 35-55 Peptide – 5mg & 10mg Vial
Price range: $210.00 through $410.00📦 Product Specifications
| Attribute | Details |
|---|---|
| Product Name | MOG 35-55 Peptide |
| Sequence | MEVGWYRSPFSRVVHLYRNGK |
| Molecular Formula | C106H160N30O24 |
| Molecular Weight | ~2132.6 g/mol |
| Purity | ≥98% (HPLC Tested) |
| Form | Lyophilized powder |
| CAS Number | 189324-69-0 |
| Solubility | Soluble in water or PBS |
| Storage | -20°C (long-term); avoid multiple freeze-thaws |
| Shelf Life | 2 years under recommended storage conditions |
| Packaging | 5mg and 10mg glass vial with sealed flip-top cap |
| Origin | Synthetic |
| Shipping | Ships cold-packed across the USA |
🔬 Research Applications of MOG 3
MOTS-c 10mg Vial
$110.00Product Name: MOTS-c
Synonyms: Mitochondrial Open Reading Frame of the 12S rRNA-c, MOTSc peptide
CAS Number: 1649242-13-1
Molecular Formula: C136H219N41O38
Molecular Weight: ~3242.6 g/mol
Purity:</strong> ≥98% (HPLC Verified)
Form: Lyophilized White Powder
Available Size: 10mg vial
Storage (Lyophilized): -20°C in dry, dark conditions
Storage (Reconstituted):</strong> 2–8°C; use within 15–30 days
Use: For Laboratory Research Use Only
NA-Selank 5mg & 10mg – Nootropic Peptide for Anxiety & Cognitive Research
Price range: $39.99 through $69.99📋 Product Specifications:
| Property | Specification |
|---|---|
| Product Name | NA-Selank |
| Form | Lyophilized peptide powder |
| Purity | ≥ 99% |
| Molecular Formula | C33H57N11O9 |
| Available Sizes | 5mg, 10mg |
| Appearance | White to off-white crystalline powder |
| Solubility | Bacteriostatic Water, Acetic Acid |
| Storage | 2°C–8°C (Refrigerated) |
| Shelf Life | 24 months (Unopened) |
| Use | Research & Laboratory Only |
NA-Selank-NH2
Price range: $44.99 through $74.99📋 Product Specifications:
| Attribute | Details |
|---|---|
| Product Name | NA-Selank-NH2 |
| Purity | ≥ 99% |
| Molecular Formula | C33H57N11O9 |
| Molecular Weight | ~735.9 g/mol |
| Form | Lyophilized powder |
| Appearance | White/off-white crystalline |
| Quantity Options | 5mg, 10mg |
| Solubility | Bacteriostatic Water, Acetic Acid |
| Storage (unopened) | 2°C–8°C (refrigerated) |
| Shelf Life | 24 months (unopened) |
| Classification | Research Use Only |
NA-Semax
Price range: $39.99 through $69.99📋 Product Specifications:
| Property | Details |
|---|---|
| Product Name | NA-Semax |
| Form | Lyophilized peptide powder |
| Purity | ≥ 99% |
| Molecular Formula | C37H51N9O10 |
| Appearance | White to off-white crystalline |
| Available Sizes | 5mg, 10mg |
| Storage | 2°C–8°C (Refrigerated) |
| Shelf Life | 24 Months (Unopened) |
| Solubility | Bacteriostatic Water, Acetic Acid |
| Classification | Research Use Only |
NA-Semax-NH₂ – High-Stability Nootropic Peptide for Cognitive & Neuroprotective Research
Price range: $44.99 through $74.99📋 Product Specifications:
| Property | Details |
|---|---|
| Product Name | NA-Semax-NHâ‚‚ |
| Available Sizes | 5mg & 10mg |
| Molecular Formula | C37H51N9O10 |
| Molecular Weight | ~763.9 g/mol |
| Purity | ≥ 99% |
| Form | Lyophilized powder |
| Solubility | Bacteriostatic Water, Acetic Acid |
| Appearance | White/off-white powder |
| Storage | 2°C–8°C (Refrigerated) |
| Shelf Life | 24 months (unopened) |
| Classification | For Research Use Only |
NAD+ (500mg / 1000mg)
Price range: $59.99 through $99.99🧾 Technical Specifications:
| Component | Specification |
|---|---|
| Chemical Name | Nicotinamide Adenine Dinucleotide |
| Form | Fine crystalline powder |
| Molecular Formula | C21H27N7O14P2 |
| Molecular Weight | 663.43 g/mol |
| Purity | ≥ 99% |
| Appearance | White to off-white powder |
| Storage Conditions | 2°C – 8°C (refrigerated) |
| Shelf Life (Unopened) | 24 months |
| Solubility | Soluble in water |
| Classification | Research Use Only |